PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G125700.1.p
Common NameGLYMA_04G125700, LOC100792349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 511aa    MW: 56418.3 Da    PI: 4.9473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G125700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-173582148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+ Ed llv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Glyma.04G125700.1.p 35 KGPWTAAEDVLLVNYVQKHGEGNWNAVQKYSGLSRCGKSCRLRWANHL 82
                         79******************************************9986 PP

2Myb_DNA-binding46.31e-1488131146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE+  ++++++++G++ W++ a+++  gRt++++k++w++
  Glyma.04G125700.1.p  88 KGAFTAEEERMIAELHAKMGNK-WARMAAHLH-GRTDNEIKNYWNT 131
                          799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3423082IPR017930Myb domain
SuperFamilySSF466892.4E-3033129IPR009057Homeodomain-like
SMARTSM007173.0E-153484IPR001005SANT/Myb domain
PfamPF002495.8E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-233689IPR009057Homeodomain-like
CDDcd001671.78E-113782No hitNo description
PROSITE profilePS5129423.41583137IPR017930Myb domain
SMARTSM007179.5E-1587135IPR001005SANT/Myb domain
PfamPF002497.8E-1488131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2590136IPR009057Homeodomain-like
CDDcd001672.42E-1090131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MSQMTNEINY NVHCNDQTGS QLNDEGNGVG MVLKKGPWTA AEDVLLVNYV QKHGEGNWNA  60
VQKYSGLSRC GKSCRLRWAN HLRPNLKKGA FTAEEERMIA ELHAKMGNKW ARMAAHLHGR  120
TDNEIKNYWN TRMKRRQRAG LPLYPPEVLL QAFQERKHGQ GTGEISNGDG GHHDFLKKNN  180
YEIHDAIFDS LKENQGILPF LPDLPAISAN SFLPNCLGSP PYCNFLPSTL PNHDHFQEST  240
MSFIGSSELN SNEFYPFDRI KDNNSDKISE SFGLYSPLDR GASSHGSICY SHSLSNGNSS  300
TSKLISEAAK SELPSLQIPE TEFGCWGTSP PPPLNESLDV FIHSPQPPNA LDSGSSPLNS  360
GLLDALLYQA NTLGCSKNNS SDKSLNSSIA TPGDRAESSA LNMYETEWED YADPLSPFGA  420
TSILNEHPVV STNGNSWDDW ELFQTFSGNN ERLQSVDQVW APKSGNQSMS LLNLTLPDVL  480
ITSDWHELYS DHDSMNQAVM TEASDDISGQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-30321361104C-Myb DNA-Binding Domain
1msf_C5e-30321361104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1871650.0AC187165.17 Glycine max cultivar Williams 82 clone gmw2-91b16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523913.10.0PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLA0A0B2SMT90.0A0A0B2SMT9_GLYSO; Transcription factor GAMYB
TrEMBLK7KJR90.0K7KJR9_SOYBN; Uncharacterized protein
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-96myb domain protein 33